SCOPe 2.08: Domain d4kdtc_: 4kdt C:

Lineage for d4kdtc_ (4kdt C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88602] (480 PDB entries)
   Uniprot P61769 21-119 ! Uniprot P01884

8. Domain d4kdtc_: 4kdt C: [224254]
   automated match to d2yxfa_
   complexed with gol, so4

Details for d4kdtc_

PDB Entry: 4kdt, 2.6 Å

PDB Description: structure of an early native-like intermediate of beta2-microglobulin amyloidosis

PDB Compounds: (C:) Beta-2-microglobulin

SCOPe Domain Sequences for d4kdtc_:

Sequence, based on SEQRES records:

>d4kdtc_ b.1.1.2 (C:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]}
tpkiqvysrhpaengksnflncyvsgfhgsdievdllkngeriekvehsdlsfskdwsfy
llyyteftptekdeyacrvnhvtlsqpkivkwdr

Sequence, based on observed residues (ATOM records):

>d4kdtc_ b.1.1.2 (C:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]}
tpkiqvysrhpengksnflncyvsgfhgsdievdllkngeriekvehsdlsfskdwsfyl
lyyteftptekdeyacrvnhvtlsqpkivkwdr

Timeline for d4kdtc_:

• d4kdtc_ first appeared in SCOPe 2.03
  
• d4kdtc_ appears in SCOPe 2.07