Lineage for d4kd6a_ (4kd6 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2100042Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2100043Protein automated matches [190246] (54 species)
    not a true protein
  7. 2100088Species Burkholderia graminis [TaxId:396598] [226732] (1 PDB entry)
  8. 2100089Domain d4kd6a_: 4kd6 A: [224252]
    automated match to d3q0jb_

Details for d4kd6a_

PDB Entry: 4kd6 (more details), 2.25 Å

PDB Description: Crystal structure of a Enoyl-CoA hydratase/isomerase from Burkholderia graminis C4D1M
PDB Compounds: (A:) enoyl-CoA hydratase/isomerase

SCOPe Domain Sequences for d4kd6a_:

Sequence, based on SEQRES records: (download)

>d4kd6a_ c.14.1.0 (A:) automated matches {Burkholderia graminis [TaxId: 396598]}
dvlfsnhgrvavitlnrperlnawttpmretiidalerfnrdpevaaiimtgagnrafsa
gqdlseahdfdgeravawvkewqryytalrslskplvmalngtaagsafqvallgdirvg
hpgvrmgqpeinagiasttgpwimnamlgmsrtieltltgrlmeaeechriglihhlvde
dkvfdkaleiatelaakppvamrldkqrfremtepgfidcieageri

Sequence, based on observed residues (ATOM records): (download)

>d4kd6a_ c.14.1.0 (A:) automated matches {Burkholderia graminis [TaxId: 396598]}
dvlfsnhgrvavitlnrperlnawttpmretiidalerfnrdpevaaiimtgagnrafsa
gqdlswvkewqryytalrslskplvmalngtaagsafqvallgdirvghpgvrmgqpein
agiasttgpwimnamlgmsrtieltltgrlmeaeechriglihhlvdedkvfdkaleiat
elaakppvamrldkqrfremtepgfidcieageri

SCOPe Domain Coordinates for d4kd6a_:

Click to download the PDB-style file with coordinates for d4kd6a_.
(The format of our PDB-style files is described here.)

Timeline for d4kd6a_: