SCOPe 2.06: Domain d4kbeb_: 4kbe B:

Lineage for d4kbeb_ (4kbe B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.0: automated matches [191321] (1 protein)
   not a true family

6. Protein automated matches [190117] (40 species)
   not a true protein

7. Species Rhizobium etli [TaxId:347834] [226336] (19 PDB entries)

8. Domain d4kbeb_: 4kbe B: [224251]
   automated match to d1lioa_
   complexed with adn, bze, dms, k

Details for d4kbeb_

PDB Entry: 4kbe, 1.8 Å

PDB Description: Crystal structure of probable sugar kinase protein from Rhizobium etli CFN 42 complexed with benzoguanamine

PDB Compounds: (B:) Probable sugar kinase protein

SCOPe Domain Sequences for d4kbeb_:

Sequence; same for both SEQRES and ATOM records:

>d4kbeb_ c.72.1.0 (B:) automated matches {Rhizobium etli [TaxId: 347834]}
mtrfdvltvgnaivdiisrcndqflidnqitkaamnlidaeraellysrmgpaleasggs
agntaagvanlggkaayfgnvaadqlgdifthdiraqgvhyqtkpkgafpptarsmifvt
edgersmntylgacvelgpedveadvvadakvtyfegylwdpprakeaildcariahqhg
remsmtlsdsfcvdryrgefldlmrsgkvdivfanrqealslyqtddfeealnriaadck
iaavtmsengavilkgreryyvnairirevvdttgagdlfasgflygytqgrsledcgkl
gclaagiviqqigprpmtslseaakqagli

Timeline for d4kbeb_:

• d4kbeb_ first appeared in SCOPe 2.03
  
• d4kbeb_ appears in SCOPe 2.05
  
• d4kbeb_ appears in SCOPe 2.07
  
• d4kbeb_ appears in the current release, SCOPe 2.08