SCOP 1.73: Domain d1qunp1: 1qun P:1-158

Lineage for d1qunp1 (1qun P:1-158)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (6 families)

5. Family b.2.3.2: Pilus subunits [49405] (5 proteins)

6. Protein Mannose-specific adhesin FimH [49406] (1 species)
   duplication: consists of two domains of this fold; C-terminal domain lacks the last strand

7. Species Escherichia coli [TaxId:562] [49407] (6 PDB entries)

8. Domain d1qunp1: 1qun P:1-158 [22425]
   Other proteins in same PDB: d1quna1, d1quna2, d1qunc1, d1qunc2, d1qune1, d1qune2, d1qung1, d1qung2, d1quni1, d1quni2, d1qunk1, d1qunk2, d1qunm1, d1qunm2, d1quno1, d1quno2

Details for d1qunp1

PDB Entry: 1qun, 2.8 Å

PDB Description: x-ray structure of the fimc-fimh chaperone adhesin complex from uropathogenic e.coli

PDB Compounds: (P:) mannose-specific adhesin fimh

SCOP Domain Sequences for d1qunp1:

Sequence; same for both SEQRES and ATOM records:

>d1qunp1 b.2.3.2 (P:1-158) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 562]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

Timeline for d1qunp1:

• d1qunp1 first appeared (with stable ids) in SCOP 1.55
  
• d1qunp1 appears in SCOP 1.71
  
• d1qunp1 appears in SCOP 1.75
  
• d1qunp1 appears in the current release, SCOPe 2.08