Lineage for d4kaeb2 (4kae B:86-214)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735625Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1735626Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1736416Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 1736417Protein automated matches [226831] (51 species)
    not a true protein
  7. 1736429Species Anaeromyxobacter dehalogenans [TaxId:455488] [226577] (3 PDB entries)
  8. 1736431Domain d4kaeb2: 4kae B:86-214 [224240]
    Other proteins in same PDB: d4kaea1, d4kaeb1
    automated match to d1e6ba1
    complexed with cit, gol, tgg

Details for d4kaeb2

PDB Entry: 4kae (more details), 1.5 Å

PDB Description: crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175, with bound dicarboxyethyl glutathione and citrate in the active site
PDB Compounds: (B:) Maleylacetoacetate isomerase

SCOPe Domain Sequences for d4kaeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kaeb2 a.45.1.0 (B:86-214) automated matches {Anaeromyxobacter dehalogenans [TaxId: 455488]}
allppdlwgrarvralaehvnsgtqpmqnalvlrmlrekvpgwdrewarffiarglaale
tavrdgagrfshgdaptladcylvpqlynarrfgldlepyptlrrvdeacaalapfqaah
pdrqpdapp

SCOPe Domain Coordinates for d4kaeb2:

Click to download the PDB-style file with coordinates for d4kaeb2.
(The format of our PDB-style files is described here.)

Timeline for d4kaeb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4kaeb1