Class a: All alpha proteins [46456] (286 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (51 species) not a true protein |
Species Anaeromyxobacter dehalogenans [TaxId:455488] [226577] (3 PDB entries) |
Domain d4kaeb2: 4kae B:86-214 [224240] Other proteins in same PDB: d4kaea1, d4kaeb1 automated match to d1e6ba1 complexed with cit, gol, tgg |
PDB Entry: 4kae (more details), 1.5 Å
SCOPe Domain Sequences for d4kaeb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kaeb2 a.45.1.0 (B:86-214) automated matches {Anaeromyxobacter dehalogenans [TaxId: 455488]} allppdlwgrarvralaehvnsgtqpmqnalvlrmlrekvpgwdrewarffiarglaale tavrdgagrfshgdaptladcylvpqlynarrfgldlepyptlrrvdeacaalapfqaah pdrqpdapp
Timeline for d4kaeb2: