SCOPe 2.08: Domain d4kaeb2: 4kae B:86-214

Lineage for d4kaeb2 (4kae B:86-214)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Anaeromyxobacter dehalogenans [TaxId:455488] [226577] (3 PDB entries)

8. Domain d4kaeb2: 4kae B:86-214 [224240]
   Other proteins in same PDB: d4kaea1, d4kaea3, d4kaeb1, d4kaeb3
   automated match to d1e6ba1
   complexed with cit, gol, tgg

Details for d4kaeb2

PDB Entry: 4kae, 1.5 Å

PDB Description: crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175, with bound dicarboxyethyl glutathione and citrate in the active site

PDB Compounds: (B:) Maleylacetoacetate isomerase

SCOPe Domain Sequences for d4kaeb2:

Sequence; same for both SEQRES and ATOM records:

>d4kaeb2 a.45.1.0 (B:86-214) automated matches {Anaeromyxobacter dehalogenans [TaxId: 455488]}
allppdlwgrarvralaehvnsgtqpmqnalvlrmlrekvpgwdrewarffiarglaale
tavrdgagrfshgdaptladcylvpqlynarrfgldlepyptlrrvdeacaalapfqaah
pdrqpdapp

Timeline for d4kaeb2:

• d4kaeb2 first appeared in SCOPe 2.03
  
• d4kaeb2 appears in SCOPe 2.07