| Class b: All beta proteins [48724] (180 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
| Family b.2.3.2: Pilus subunits [49405] (11 proteins) |
| Protein Mannose-specific adhesin FimH, C-terminal domain [418901] (2 species) protein duplication: consists of two domains of this fold; C-terminal domain lacks the last strand |
| Species Escherichia coli [TaxId:562] [419301] (4 PDB entries) |
| Domain d1qunn2: 1qun N:159-279 [22424] Other proteins in same PDB: d1quna1, d1quna2, d1qunb1, d1qunc1, d1qunc2, d1qund1, d1qune1, d1qune2, d1qunf1, d1qung1, d1qung2, d1qunh1, d1quni1, d1quni2, d1qunj1, d1qunk1, d1qunk2, d1qunl1, d1qunm1, d1qunm2, d1qunn1, d1quno1, d1quno2, d1qunp1 missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1qun (more details), 2.8 Å
SCOPe Domain Sequences for d1qunn2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qunn2 b.2.3.2 (N:159-279) Mannose-specific adhesin FimH, C-terminal domain {Escherichia coli [TaxId: 562]}
ggcdvsardvtvtlpdypgsvpipltvycaksqnlgyylsgttadagnsiftntasfspa
qgvgvqltrngtiipanntvslgavgtsavslgltanyartggqvtagnvqsiigvtfvy
q
Timeline for d1qunn2:
View in 3DDomains from other chains: (mouse over for more information) d1quna1, d1quna2, d1qunb1, d1qunb2, d1qunc1, d1qunc2, d1qund1, d1qund2, d1qune1, d1qune2, d1qunf1, d1qunf2, d1qung1, d1qung2, d1qunh1, d1qunh2, d1quni1, d1quni2, d1qunj1, d1qunj2, d1qunk1, d1qunk2, d1qunl1, d1qunl2, d1qunm1, d1qunm2, d1quno1, d1quno2, d1qunp1, d1qunp2 |