Lineage for d4kaeb1 (4kae B:1-85)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879023Species Anaeromyxobacter dehalogenans [TaxId:455488] [226576] (3 PDB entries)
  8. 2879029Domain d4kaeb1: 4kae B:1-85 [224239]
    Other proteins in same PDB: d4kaea2, d4kaea3, d4kaeb2, d4kaeb3
    automated match to d1e6ba2
    complexed with cit, gol, tgg

Details for d4kaeb1

PDB Entry: 4kae (more details), 1.5 Å

PDB Description: crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175, with bound dicarboxyethyl glutathione and citrate in the active site
PDB Compounds: (B:) Maleylacetoacetate isomerase

SCOPe Domain Sequences for d4kaeb1:

Sequence, based on SEQRES records: (download)

>d4kaeb1 c.47.1.0 (B:1-85) automated matches {Anaeromyxobacter dehalogenans [TaxId: 455488]}
mtlrlysywrsssawrvrlglalkglayeyravdllaqeqfqaahqarnpmsqvpvleve
edgrthllvqsmailewleerhpep

Sequence, based on observed residues (ATOM records): (download)

>d4kaeb1 c.47.1.0 (B:1-85) automated matches {Anaeromyxobacter dehalogenans [TaxId: 455488]}
mtlrlysywrsssawrvrlglalkglayeyravdllaqeqfqaahqarnsqvpvleveed
grthllvqsmailewleerhpep

SCOPe Domain Coordinates for d4kaeb1:

Click to download the PDB-style file with coordinates for d4kaeb1.
(The format of our PDB-style files is described here.)

Timeline for d4kaeb1: