Lineage for d4kaea2 (4kae A:86-220)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2713811Species Anaeromyxobacter dehalogenans [TaxId:455488] [226577] (3 PDB entries)
  8. 2713816Domain d4kaea2: 4kae A:86-220 [224238]
    Other proteins in same PDB: d4kaea1, d4kaea3, d4kaeb1, d4kaeb3
    automated match to d1e6ba1
    complexed with cit, gol, tgg

Details for d4kaea2

PDB Entry: 4kae (more details), 1.5 Å

PDB Description: crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175, with bound dicarboxyethyl glutathione and citrate in the active site
PDB Compounds: (A:) Maleylacetoacetate isomerase

SCOPe Domain Sequences for d4kaea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kaea2 a.45.1.0 (A:86-220) automated matches {Anaeromyxobacter dehalogenans [TaxId: 455488]}
allppdlwgrarvralaehvnsgtqpmqnalvlrmlrekvpgwdrewarffiarglaale
tavrdgagrfshgdaptladcylvpqlynarrfgldlepyptlrrvdeacaalapfqaah
pdrqpdapppdrrtp

SCOPe Domain Coordinates for d4kaea2:

Click to download the PDB-style file with coordinates for d4kaea2.
(The format of our PDB-style files is described here.)

Timeline for d4kaea2: