![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
![]() | Protein automated matches [226831] (73 species) not a true protein |
![]() | Species Anaeromyxobacter dehalogenans [TaxId:455488] [226577] (3 PDB entries) |
![]() | Domain d4kaea2: 4kae A:86-220 [224238] Other proteins in same PDB: d4kaea1, d4kaea3, d4kaeb1, d4kaeb3 automated match to d1e6ba1 complexed with cit, gol, tgg |
PDB Entry: 4kae (more details), 1.5 Å
SCOPe Domain Sequences for d4kaea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kaea2 a.45.1.0 (A:86-220) automated matches {Anaeromyxobacter dehalogenans [TaxId: 455488]} allppdlwgrarvralaehvnsgtqpmqnalvlrmlrekvpgwdrewarffiarglaale tavrdgagrfshgdaptladcylvpqlynarrfgldlepyptlrrvdeacaalapfqaah pdrqpdapppdrrtp
Timeline for d4kaea2: