Lineage for d4k9va_ (4k9v A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005432Protein automated matches [190068] (9 species)
    not a true protein
  7. 2005449Species Human (Homo sapiens) [TaxId:9606] [189507] (40 PDB entries)
  8. 2005480Domain d4k9va_: 4k9v A: [224226]
    automated match to d3ua1a_
    complexed with 6aw, hem

Details for d4k9va_

PDB Entry: 4k9v (more details), 2.6 Å

PDB Description: complex of cyp3a4 with a desoxyritonavir analog
PDB Compounds: (A:) cytochrome p450 3a4

SCOPe Domain Sequences for d4k9va_:

Sequence, based on SEQRES records: (download)

>d4k9va_ a.104.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlaitdp
dmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkemvp
iiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfvent
kkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrledtqkh
rvdflqlmidsqnsketeshkalsdlelvaqsiififagyettssvlsfimyelathpdv
qqklqeeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdveingmf
ipkgvvvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgprncigmrf
almnmklalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesr

Sequence, based on observed residues (ATOM records): (download)

>d4k9va_ a.104.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlaitdp
dmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkemvp
iiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfvent
kkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrledtvdf
lqlmidsqalsdlelvaqsiififagyettssvlsfimyelathpdvqqklqeeidavlp
nkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdveingmfipkgvvvmipsya
lhrdpkywtepekflperfskknkdnidpyiytpfgsgprncigmrfalmnmklalirvl
qnfsfkpcketqiplklslggllqpekpvvlkvesr

SCOPe Domain Coordinates for d4k9va_:

Click to download the PDB-style file with coordinates for d4k9va_.
(The format of our PDB-style files is described here.)

Timeline for d4k9va_: