| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (6 families) ![]() has extra strand located between strands 2 and 3 |
| Family c.72.1.0: automated matches [191321] (1 protein) not a true family |
| Protein automated matches [190117] (50 species) not a true protein |
| Species Rhizobium etli [TaxId:347834] [226336] (19 PDB entries) |
| Domain d4k8tb_: 4k8t B: [224213] automated match to d1lioa_ complexed with adn, dms, e34, k |
PDB Entry: 4k8t (more details), 1.7 Å
SCOPe Domain Sequences for d4k8tb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k8tb_ c.72.1.0 (B:) automated matches {Rhizobium etli [TaxId: 347834]}
mtrfdvltvgnaivdiisrcndqflidnqitkaamnlidaeraellysrmgpaleasggs
agntaagvanlggkaayfgnvaadqlgdifthdiraqgvhyqtkpkgafpptarsmifvt
edgersmntylgacvelgpedveadvvadakvtyfegylwdpprakeaildcariahqhg
remsmtlsdsfcvdryrgefldlmrsgkvdivfanrqealslyqtddfeealnriaadck
iaavtmsengavilkgreryyvnairirevvdttgagdlfasgflygytqgrsledcgkl
gclaagiviqqigprpmtslseaakqagli
Timeline for d4k8tb_: