SCOPe 2.08: Domain d4k8ta_: 4k8t A:

Lineage for d4k8ta_ (4k8t A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.0: automated matches [191321] (1 protein)
   not a true family

6. Protein automated matches [190117] (50 species)
   not a true protein

7. Species Rhizobium etli [TaxId:347834] [226336] (19 PDB entries)

8. Domain d4k8ta_: 4k8t A: [224212]
   automated match to d1lioa_
   complexed with adn, dms, e34, k

Details for d4k8ta_

PDB Entry: 4k8t, 1.7 Å

PDB Description: Crystal structure of probable sugar kinase protein from Rhizobium etli CFN 42 complexed with ethyl 3,4-diaminobenzoate

PDB Compounds: (A:) Sugar kinase

SCOPe Domain Sequences for d4k8ta_:

Sequence; same for both SEQRES and ATOM records:

>d4k8ta_ c.72.1.0 (A:) automated matches {Rhizobium etli [TaxId: 347834]}
mtrfdvltvgnaivdiisrcndqflidnqitkaamnlidaeraellysrmgpaleasggs
agntaagvanlggkaayfgnvaadqlgdifthdiraqgvhyqtkpkgafpptarsmifvt
edgersmntylgacvelgpedveadvvadakvtyfegylwdpprakeaildcariahqhg
remsmtlsdsfcvdryrgefldlmrsgkvdivfanrqealslyqtddfeealnriaadck
iaavtmsengavilkgreryyvnairirevvdttgagdlfasgflygytqgrsledcgkl
gclaagiviqqigprpmtslseaakqagli

Timeline for d4k8ta_:

• d4k8ta_ first appeared in SCOPe 2.03
  
• d4k8ta_ appears in SCOPe 2.07