Lineage for d4k7xa1 (4k7x A:1-310)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546594Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 2546595Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 2546724Family d.21.1.0: automated matches [191386] (1 protein)
    not a true family
  6. 2546725Protein automated matches [190491] (18 species)
    not a true protein
  7. 2546744Species Burkholderia multivorans [TaxId:395019] [226654] (2 PDB entries)
  8. 2546745Domain d4k7xa1: 4k7x A:1-310 [224202]
    Other proteins in same PDB: d4k7xa2
    automated match to d1tm0a_
    complexed with cl, gol, na, po4

Details for d4k7xa1

PDB Entry: 4k7x (more details), 1.75 Å

PDB Description: Crystal structure of a 4-hydroxyproline epimerase from burkholderia multivorans, target efi-506479, with bound phosphate, closed domains
PDB Compounds: (A:) proline racemase

SCOPe Domain Sequences for d4k7xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k7xa1 d.21.1.0 (A:1-310) automated matches {Burkholderia multivorans [TaxId: 395019]}
mmkriqiidshtggeptrlvvsgfpslgsgtmaerrdvlareydryrtacileprgsdvl
vgallcepvspdaaagviffnnsgylgmcghgtigvvrtlhhmgrigpgvhrietpvgtv
eatlhddlsvsvrnvlayrhakdvaldvpgygpvrgdiawggnwfflisdhgqrvagdnv
aaltayasavregleragitganggeidhielfaddpehdsrsfvlcpglaydrspcgtg
tsaklaclaadgklapgavwrqasvigsvfhasyvqaeggivptirgsahlsaeatllie
dddpfrwgiv

SCOPe Domain Coordinates for d4k7xa1:

Click to download the PDB-style file with coordinates for d4k7xa1.
(The format of our PDB-style files is described here.)

Timeline for d4k7xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4k7xa2