Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily) mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix |
Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) duplication: consists of two similar domain swapped with C-terminal strands |
Family d.21.1.0: automated matches [191386] (1 protein) not a true family |
Protein automated matches [190491] (18 species) not a true protein |
Species Burkholderia multivorans [TaxId:395019] [226654] (2 PDB entries) |
Domain d4k7xa1: 4k7x A:1-310 [224202] Other proteins in same PDB: d4k7xa2 automated match to d1tm0a_ complexed with cl, gol, na, po4 |
PDB Entry: 4k7x (more details), 1.75 Å
SCOPe Domain Sequences for d4k7xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k7xa1 d.21.1.0 (A:1-310) automated matches {Burkholderia multivorans [TaxId: 395019]} mmkriqiidshtggeptrlvvsgfpslgsgtmaerrdvlareydryrtacileprgsdvl vgallcepvspdaaagviffnnsgylgmcghgtigvvrtlhhmgrigpgvhrietpvgtv eatlhddlsvsvrnvlayrhakdvaldvpgygpvrgdiawggnwfflisdhgqrvagdnv aaltayasavregleragitganggeidhielfaddpehdsrsfvlcpglaydrspcgtg tsaklaclaadgklapgavwrqasvigsvfhasyvqaeggivptirgsahlsaeatllie dddpfrwgiv
Timeline for d4k7xa1: