SCOPe 2.08: Domain d4k7xa1: 4k7x A:1-310

Lineage for d4k7xa1 (4k7x A:1-310)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.0: automated matches [191386] (1 protein)
   not a true family

6. Protein automated matches [190491] (18 species)
   not a true protein

7. Species Burkholderia multivorans [TaxId:395019] [226654] (2 PDB entries)

8. Domain d4k7xa1: 4k7x A:1-310 [224202]
   Other proteins in same PDB: d4k7xa2
   automated match to d1tm0a_
   complexed with cl, gol, na, po4

Details for d4k7xa1

PDB Entry: 4k7x, 1.75 Å

PDB Description: Crystal structure of a 4-hydroxyproline epimerase from burkholderia multivorans, target efi-506479, with bound phosphate, closed domains

PDB Compounds: (A:) proline racemase

SCOPe Domain Sequences for d4k7xa1:

Sequence; same for both SEQRES and ATOM records:

>d4k7xa1 d.21.1.0 (A:1-310) automated matches {Burkholderia multivorans [TaxId: 395019]}
mmkriqiidshtggeptrlvvsgfpslgsgtmaerrdvlareydryrtacileprgsdvl
vgallcepvspdaaagviffnnsgylgmcghgtigvvrtlhhmgrigpgvhrietpvgtv
eatlhddlsvsvrnvlayrhakdvaldvpgygpvrgdiawggnwfflisdhgqrvagdnv
aaltayasavregleragitganggeidhielfaddpehdsrsfvlcpglaydrspcgtg
tsaklaclaadgklapgavwrqasvigsvfhasyvqaeggivptirgsahlsaeatllie
dddpfrwgiv

Timeline for d4k7xa1:

• d4k7xa1 first appeared in SCOPe 2.03, called d4k7xa_
  
• d4k7xa1 appears in SCOPe 2.07