SCOPe 2.07: Domain d1qunj2: 1qun J:159-279

Lineage for d1qunj2 (1qun J:159-279)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (10 proteins)

6. Protein Mannose-specific adhesin FimH [49406] (2 species)
   duplication: consists of two domains of this fold; C-terminal domain lacks the last strand

7. Species Escherichia coli [TaxId:562] [49407] (25 PDB entries)

8. Domain d1qunj2: 1qun J:159-279 [22420]
   Other proteins in same PDB: d1quna1, d1quna2, d1qunc1, d1qunc2, d1qune1, d1qune2, d1qung1, d1qung2, d1quni1, d1quni2, d1qunk1, d1qunk2, d1qunm1, d1qunm2, d1quno1, d1quno2

Details for d1qunj2

PDB Entry: 1qun, 2.8 Å

PDB Description: x-ray structure of the fimc-fimh chaperone adhesin complex from uropathogenic e.coli

PDB Compounds: (J:) mannose-specific adhesin fimh

SCOPe Domain Sequences for d1qunj2:

Sequence; same for both SEQRES and ATOM records:

>d1qunj2 b.2.3.2 (J:159-279) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 562]}
ggcdvsardvtvtlpdypgsvpipltvycaksqnlgyylsgttadagnsiftntasfspa
qgvgvqltrngtiipanntvslgavgtsavslgltanyartggqvtagnvqsiigvtfvy
q

Timeline for d1qunj2:

• d1qunj2 first appeared (with stable ids) in SCOP 1.55
  
• d1qunj2 appears in SCOPe 2.06
  
• d1qunj2 appears in the current release, SCOPe 2.08