Lineage for d1qunj2 (1qun J:159-279)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 55312Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)
  4. 55371Superfamily b.2.3: Bacterial adhesins [49401] (3 families) (S)
  5. 55376Family b.2.3.2: Pilus subunits [49405] (2 proteins)
  6. 55377Protein Mannose-specific adhesin FimH [49406] (1 species)
  7. 55378Species Escherichia coli [TaxId:562] [49407] (1 PDB entry)
  8. 55388Domain d1qunj2: 1qun J:159-279 [22420]
    Other proteins in same PDB: d1quna1, d1quna2, d1qunc1, d1qunc2, d1qune1, d1qune2, d1qung1, d1qung2, d1quni1, d1quni2, d1qunk1, d1qunk2, d1qunm1, d1qunm2, d1quno1, d1quno2

Details for d1qunj2

PDB Entry: 1qun (more details), 2.8 Å

PDB Description: x-ray structure of the fimc-fimh chaperone adhesin complex from uropathogenic e.coli

SCOP Domain Sequences for d1qunj2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qunj2 b.2.3.2 (J:159-279) Mannose-specific adhesin FimH {Escherichia coli}
ggcdvsardvtvtlpdypgsvpipltvycaksqnlgyylsgttadagnsiftntasfspa
qgvgvqltrngtiipanntvslgavgtsavslgltanyartggqvtagnvqsiigvtfvy
q

SCOP Domain Coordinates for d1qunj2:

Click to download the PDB-style file with coordinates for d1qunj2.
(The format of our PDB-style files is described here.)

Timeline for d1qunj2: