SCOPe 2.06: Domain d4k6lg_: 4k6l G:

Lineage for d4k6lg_ (4k6l G:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.0: automated matches [191650] (1 protein)
   not a true family

6. Protein automated matches [191197] (9 species)
   not a true protein

7. Species Salmonella enterica [TaxId:90370] [226726] (1 PDB entry)

8. Domain d4k6lg_: 4k6l G: [224185]
   Other proteins in same PDB: d4k6lf_
   automated match to d1prta_
   complexed with gol

Details for d4k6lg_

PDB Entry: 4k6l, 2.39 Å

PDB Description: Structure of Typhoid Toxin

PDB Compounds: (G:) Putative pertussis-like toxin subunit

SCOPe Domain Sequences for d4k6lg_:

Sequence; same for both SEQRES and ATOM records:

>d4k6lg_ d.166.1.0 (G:) automated matches {Salmonella enterica [TaxId: 90370]}
vdfvyrvdstppdvifrdgfsllgynrnfqqfisgrscsggssdsryiattssvnqtyai
arayysrstfkgnlyryqiradnnfysllpsityletqgghfnayektmmrlqreyvstl
silpeniqkavalvydsatglvkdgvstmnasylglsttsnpgvipflpepqtytqqrid
afgplisscfsigsvchshrgqradvynmsfydarpvielilsk

Timeline for d4k6lg_:

• d4k6lg_ first appeared in SCOPe 2.03
  
• d4k6lg_ appears in SCOPe 2.05
  
• d4k6lg_ appears in SCOPe 2.07
  
• d4k6lg_ appears in the current release, SCOPe 2.08