Lineage for d4k6lg_ (4k6l G:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1441943Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 1441944Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 1442208Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 1442209Protein automated matches [191197] (5 species)
    not a true protein
  7. 1442261Species Salmonella enterica [TaxId:90370] [226726] (1 PDB entry)
  8. 1442262Domain d4k6lg_: 4k6l G: [224185]
    Other proteins in same PDB: d4k6lf_
    automated match to d1prta_
    complexed with gol

Details for d4k6lg_

PDB Entry: 4k6l (more details), 2.39 Å

PDB Description: Structure of Typhoid Toxin
PDB Compounds: (G:) Putative pertussis-like toxin subunit

SCOPe Domain Sequences for d4k6lg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k6lg_ d.166.1.0 (G:) automated matches {Salmonella enterica [TaxId: 90370]}
vdfvyrvdstppdvifrdgfsllgynrnfqqfisgrscsggssdsryiattssvnqtyai
arayysrstfkgnlyryqiradnnfysllpsityletqgghfnayektmmrlqreyvstl
silpeniqkavalvydsatglvkdgvstmnasylglsttsnpgvipflpepqtytqqrid
afgplisscfsigsvchshrgqradvynmsfydarpvielilsk

SCOPe Domain Coordinates for d4k6lg_:

Click to download the PDB-style file with coordinates for d4k6lg_.
(The format of our PDB-style files is described here.)

Timeline for d4k6lg_: