![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.151: DNase I-like [56218] (1 superfamily) contains beta-sandwich; duplication of alpha+beta motif |
![]() | Superfamily d.151.1: DNase I-like [56219] (4 families) ![]() |
![]() | Family d.151.1.0: automated matches [191468] (1 protein) not a true family |
![]() | Protein automated matches [190734] (14 species) not a true protein |
![]() | Species Salmonella enterica [TaxId:90370] [226727] (1 PDB entry) |
![]() | Domain d4k6lf_: 4k6l F: [224184] Other proteins in same PDB: d4k6lg_ automated match to d1sr4b_ complexed with gol |
PDB Entry: 4k6l (more details), 2.39 Å
SCOPe Domain Sequences for d4k6lf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k6lf_ d.151.1.0 (F:) automated matches {Salmonella enterica [TaxId: 90370]} nisdykvmtwnlqgssasteskwnvnvrqllsgtagvdilmvqeagavptsavptgrhiq pfgvgipideytwnlgttsrqdiryiyhsaidvgarrvnlaivsrqradnvyvlrpttva srpvigiglgndvfltahalasggpdaaaivrvtinffrqpqmrhlswflagdfnrspdr lendlmtehlervvavlapteptqigggildygvivdrapysqrvealrnpqlasdhypv aflarsc
Timeline for d4k6lf_: