SCOPe 2.06: Domain d4k6lf_: 4k6l F:

Lineage for d4k6lf_ (4k6l F:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.151: DNase I-like [56218] (1 superfamily)
   contains beta-sandwich; duplication of alpha+beta motif

4. Superfamily d.151.1: DNase I-like [56219] (4 families)

5. Family d.151.1.0: automated matches [191468] (1 protein)
   not a true family

6. Protein automated matches [190734] (12 species)
   not a true protein

7. Species Salmonella enterica [TaxId:90370] [226727] (1 PDB entry)

8. Domain d4k6lf_: 4k6l F: [224184]
   Other proteins in same PDB: d4k6lg_
   automated match to d1sr4b_
   complexed with gol

Details for d4k6lf_

PDB Entry: 4k6l, 2.39 Å

PDB Description: Structure of Typhoid Toxin

PDB Compounds: (F:) Cytolethal distending toxin subunit B homolog

SCOPe Domain Sequences for d4k6lf_:

Sequence; same for both SEQRES and ATOM records:

>d4k6lf_ d.151.1.0 (F:) automated matches {Salmonella enterica [TaxId: 90370]}
nisdykvmtwnlqgssasteskwnvnvrqllsgtagvdilmvqeagavptsavptgrhiq
pfgvgipideytwnlgttsrqdiryiyhsaidvgarrvnlaivsrqradnvyvlrpttva
srpvigiglgndvfltahalasggpdaaaivrvtinffrqpqmrhlswflagdfnrspdr
lendlmtehlervvavlapteptqigggildygvivdrapysqrvealrnpqlasdhypv
aflarsc

Timeline for d4k6lf_:

• d4k6lf_ first appeared in SCOPe 2.03
  
• d4k6lf_ appears in SCOPe 2.05
  
• d4k6lf_ appears in SCOPe 2.07
  
• d4k6lf_ appears in the current release, SCOPe 2.08