Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (309 species) not a true protein |
Species Burkholderia cenocepacia [TaxId:216591] [193149] (10 PDB entries) |
Domain d4k6fd_: 4k6f D: [224183] automated match to d4k6cb_ complexed with nap |
PDB Entry: 4k6f (more details), 1.5 Å
SCOPe Domain Sequences for d4k6fd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k6fd_ c.2.1.0 (D:) automated matches {Burkholderia cenocepacia [TaxId: 216591]} kriavvtggmgglgeavsirlndaghrvvvtyspnntgadrwltemhaagrefhaypvdv adhdscqqciekivrdvgpvdilvnnagitrdmtlrkldkvnwdavirtnldsvfnmtkp vcdgmvergwgrivnissvngskgsvgqtnyaaakagmhgftkslaleiarkgvtvntvs pgylatkmvtaipqdildtkilpqipagrlgkpeevaalvaylcseeagfvtgsniaing gqhmh
Timeline for d4k6fd_: