Lineage for d4k69a_ (4k69 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2064431Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2064624Protein Chymase (mast cell protease I) [89343] (1 species)
  7. 2064625Species Human (Homo sapiens) [TaxId:9606] [89344] (11 PDB entries)
  8. 2064627Domain d4k69a_: 4k69 A: [224179]
    automated match to d1pjpa_
    complexed with 1p9, nag, zn

Details for d4k69a_

PDB Entry: 4k69 (more details), 1.5 Å

PDB Description: crystal structure of human chymase in complex with fragment linked benzimidazolone inhibitor: (3s)-3-{3-[(6-bromo-2-oxo-2,3-dihydro-1h- indol-4-yl)methyl]-2-oxo-2,3-dihydro-1h-benzimidazol-1-yl}hexanoic acid
PDB Compounds: (A:) Chymase

SCOPe Domain Sequences for d4k69a_:

Sequence, based on SEQRES records: (download)

>d4k69a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]}
iiggteckphsrpymayleivtsngpskfcggflirrnfvltaahcagrsitvtlgahni
teeedtwqklevikqfrhpkyntstlhhdimllklkekasltlavgtlpfpsqknfvppg
rmcrvagwgrtgvlkpgsdtlqevklrlmdpqacshfrdfdhnlqlcvgnprktksafkg
dsggpllcagaaqgivsygrsdakppavftrishyqpwinqilqan

Sequence, based on observed residues (ATOM records): (download)

>d4k69a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]}
iiggteckphsrpymayleivtsngpskfcggflirrnfvltaahcagrsitvtlgahni
teeedtwqklevikqfrhpkyntstlhhdimllklkekasltlavgtlgrmcrvagwgrt
gvlkpgsdtlqevklrlmdpqacshfrdfdhnlqlcvgnprktksafkgdsggpllcaga
aqgivsygrsdakppavftrishyqpwinqilqan

SCOPe Domain Coordinates for d4k69a_:

Click to download the PDB-style file with coordinates for d4k69a_.
(The format of our PDB-style files is described here.)

Timeline for d4k69a_: