Lineage for d4k62e_ (4k62 E:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778135Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1778136Protein Hemagglutinin [49824] (7 species)
    includes rudiment esterase domain
  7. 1778153Species Influenza A virus, different strains [TaxId:11320] [49825] (105 PDB entries)
  8. 1778245Domain d4k62e_: 4k62 E: [224173]
    Other proteins in same PDB: d4k62b_, d4k62d_, d4k62f_, d4k62h_
    automated match to d4k64a_
    complexed with nag

Details for d4k62e_

PDB Entry: 4k62 (more details), 2.5 Å

PDB Description: structure of an avian influenza h5 hemagglutinin from the influenza virus a/indonesia/5/2005
PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d4k62e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k62e_ b.19.1.2 (E:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
qdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvag
wllgnpmcdefinvpewsyivekanptndlcypgsfndyeelkhllsrinhfekiqiipk
sswsdheassgvssacpylgspsffrnvvwlikknstyptikksynntnqedllvlwgih
hpndaaeqtrlyqnpttyisigtstlnqrlvpkiatrskvngqsgrmeffwtilkpndai
nfesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihplti
gecpkyvksnrlvlatglrns

SCOPe Domain Coordinates for d4k62e_:

Click to download the PDB-style file with coordinates for d4k62e_.
(The format of our PDB-style files is described here.)

Timeline for d4k62e_: