SCOPe 2.08: Domain d4k55a1: 4k55 A:3-116

Lineage for d4k55a1 (4k55 A:3-116)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4k55a1: 4k55 A:3-116 [224169]
   Other proteins in same PDB: d4k55a2
   automated match to d1pkqe_
   complexed with h6p

Details for d4k55a1

PDB Entry: 4k55, 1.91 Å

PDB Description: Structure of the extracellular domain of butyrophilin BTN3A1 in complex with (E)-4-hydroxy-3-methyl-but-2-enyl pyrophosphate (HMBPP)

PDB Compounds: (A:) Butyrophilin subfamily 3 member A1

SCOPe Domain Sequences for d4k55a1:

Sequence; same for both SEQRES and ATOM records:

>d4k55a1 b.1.1.0 (A:3-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qfsvlgpsgpilamvgedadlpchlfptmsaetmelkwvssslrqvvnvyadgkevedrq
sapyrgrtsilrdgitagkaalrihnvtasdsgkylcyfqdgdfyekalvelkv

Timeline for d4k55a1:

• d4k55a1 first appeared in SCOPe 2.03, called d4k55a_
  
• d4k55a1 appears in SCOPe 2.07