SCOPe 2.08: Domain d4k44b1: 4k44 B:664-765

Lineage for d4k44b1 (4k44 B:664-765)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein Phospholipase C-gamma-1 [55577] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [226824] (3 PDB entries)

8. Domain d4k44b1: 4k44 B:664-765 [224160]
   Other proteins in same PDB: d4k44a2, d4k44b2
   automated match to d3s9ka_

Details for d4k44b1

PDB Entry: 4k44, 1.7 Å

PDB Description: Auto-inhibition and phosphorylation-induced activation of PLC-gamma isozymes

PDB Compounds: (B:) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1

SCOPe Domain Sequences for d4k44b1:

Sequence; same for both SEQRES and ATOM records:

>d4k44b1 d.93.1.1 (B:664-765) Phospholipase C-gamma-1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eskewyhasltraqaehmlmrvprdgaflvrkrnepnsyaisfraegkikhcrvqqegqt
vmlgnsefdslvdlisyyekhplyrkmklrypineealekig

Timeline for d4k44b1:

• d4k44b1 first appeared in SCOPe 2.03, called d4k44b_
  
• d4k44b1 appears in SCOPe 2.07