| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) ![]() |
| Family d.131.1.1: DNA polymerase III, beta subunit [55980] (1 protein) duplication: consists of three domains of this fold |
| Protein DNA polymerase III, beta subunit [55981] (2 species) |
| Species Escherichia coli [TaxId:562] [55982] (30 PDB entries) Uniprot P00583 |
| Domain d4k3ka2: 4k3k A:123-244 [224142] automated match to d1ok7a2 complexed with ca, cl, peg, pg4, sfk |
PDB Entry: 4k3k (more details), 1.85 Å
SCOPe Domain Sequences for d4k3ka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k3ka2 d.131.1.1 (A:123-244) DNA polymerase III, beta subunit {Escherichia coli [TaxId: 562]}
qseveftlpqatmkrlieatqfsmahqdvryylngmlfetegeelrtvatdghrlavcsm
pigqslpshsvivprkgvielmrmldggdnplrvqigsnnirahvgdfiftsklvdgrfp
dy
Timeline for d4k3ka2: