| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [226022] (18 PDB entries) |
| Domain d4k3em2: 4k3e M:108-211 [224138] automated match to d1aqkl2 complexed with tla |
PDB Entry: 4k3e (more details), 2.2 Å
SCOPe Domain Sequences for d4k3em2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k3em2 b.1.1.0 (M:108-211) automated matches {Cow (Bos taurus) [TaxId: 9913]}
qpksppsvtlfppsteelngnkatlvclisdfypgsvtvvwkadgstitrnvettraskq
snskyaassylsltssdwkskgsyscevthegstvtktvkpsec
Timeline for d4k3em2: