![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (28 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [226022] (8 PDB entries) |
![]() | Domain d4k3el2: 4k3e L:108-212 [224136] automated match to d1aqkl2 complexed with tla |
PDB Entry: 4k3e (more details), 2.2 Å
SCOPe Domain Sequences for d4k3el2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k3el2 b.1.1.0 (L:108-212) automated matches {Cow (Bos taurus) [TaxId: 9913]} qpksppsvtlfppsteelngnkatlvclisdfypgsvtvvwkadgstitrnvettraskq snskyaassylsltssdwkskgsyscevthegstvtktvkpsecs
Timeline for d4k3el2: