SCOPe 2.08: Domain d4k3dm1: 4k3d M:3-107

Lineage for d4k3dm1 (4k3d M:3-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226022] (18 PDB entries)

8. Domain d4k3dm1: 4k3d M:3-107 [224133]
   automated match to d1aqkl1
   complexed with cit, k

Details for d4k3dm1

PDB Entry: 4k3d, 1.85 Å

PDB Description: Crystal structure of bovine antibody BLV1H12 with ultralong CDR H3

PDB Compounds: (M:) bovine antibody with ultralong cdr h3, light chain

SCOPe Domain Sequences for d4k3dm1:

Sequence; same for both SEQRES and ATOM records:

>d4k3dm1 b.1.1.0 (M:3-107) automated matches {Cow (Bos taurus) [TaxId: 9913]}
vlnqpssvsgslgqrvsitcsgsssnvgngyvswyqlipgsaprtliygdtsrasgvpdr
fsgsrsgntatltisslqaedeadyfcasaedsssnavfgsgttltvlg

Timeline for d4k3dm1:

• d4k3dm1 first appeared in SCOPe 2.03
  
• d4k3dm1 appears in SCOPe 2.07