Lineage for d4k2ya_ (4k2y A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2387819Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2388012Protein Chymase (mast cell protease I) [89343] (1 species)
  7. 2388013Species Human (Homo sapiens) [TaxId:9606] [89344] (13 PDB entries)
  8. 2388023Domain d4k2ya_: 4k2y A: [224129]
    automated match to d1pjpa_
    complexed with es2, nag, zn

Details for d4k2ya_

PDB Entry: 4k2y (more details), 2.3 Å

PDB Description: Crystal Structure of Human Chymase in Complex with Fragment Inhibitor 6-chloro-1,3-dihydro-2H-indol-2-one
PDB Compounds: (A:) Chymase

SCOPe Domain Sequences for d4k2ya_:

Sequence, based on SEQRES records: (download)

>d4k2ya_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]}
iiggteckphsrpymayleivtsngpskfcggflirrnfvltaahcagrsitvtlgahni
teeedtwqklevikqfrhpkyntstlhhdimllklkekasltlavgtlpfpsqknfvppg
rmcrvagwgrtgvlkpgsdtlqevklrlmdpqacshfrdfdhnlqlcvgnprktksafkg
dsggpllcagaaqgivsygrsdakppavftrishyqpwinqilqan

Sequence, based on observed residues (ATOM records): (download)

>d4k2ya_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]}
iiggteckphsrpymayleivtsngpskfcggflirrnfvltaahcagrsitvtlgahni
teeedtwqklevikqfrhpkyntstlhhdimllklkekasltlavgtlppgrmcrvagwg
rtgvlkpgsdtlqevklrlmdpqacshfrdfdhnlqlcvgnprktksafkgdsggpllca
gaaqgivsygrsdakppavftrishyqpwinqilqan

SCOPe Domain Coordinates for d4k2ya_:

Click to download the PDB-style file with coordinates for d4k2ya_.
(The format of our PDB-style files is described here.)

Timeline for d4k2ya_: