![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
![]() | Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) ![]() automatically mapped to Pfam PF02777 |
![]() | Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
![]() | Protein automated matches [226860] (30 species) not a true protein |
![]() | Species Babesia bovis [TaxId:5865] [226663] (2 PDB entries) |
![]() | Domain d4k2wb2: 4k2w B:84-199 [224128] Other proteins in same PDB: d4k2wa1, d4k2wb1 automated match to d1gv3a2 complexed with zn |
PDB Entry: 4k2w (more details), 1.75 Å
SCOPe Domain Sequences for d4k2wb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k2wb2 d.44.1.0 (B:84-199) automated matches {Babesia bovis [TaxId: 5865]} ncggeptgpirkkieekfgsfsafktdfsnllaghfgsgwgwlvlkddgtadivqthdag splkenlgrpllccdvwehayyidykndrlsyinswwnlvnwdfanknleapfkws
Timeline for d4k2wb2: