SCOPe 2.05: Domain d4k2wb1: 4k2w B:0-83

Lineage for d4k2wb1 (4k2w B:0-83)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (31 species)
   not a true protein

7. Species Babesia bovis [TaxId:5865] [226662] (2 PDB entries)

8. Domain d4k2wb1: 4k2w B:0-83 [224127]
   Other proteins in same PDB: d4k2wa2, d4k2wb2
   automated match to d1gv3a1
   complexed with zn

Details for d4k2wb1

PDB Entry: 4k2w, 1.75 Å

PDB Description: x-ray crystal structure of superoxide dismutase from babesia bovis solved by sulfur/zinc sad

PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d4k2wb1:

Sequence; same for both SEQRES and ATOM records:

>d4k2wb1 a.2.11.0 (B:0-83) automated matches {Babesia bovis [TaxId: 5865]}
smafklpalpygmreliphiseetlsfhygkhhagyvnklnslikgtpmesctieelilg
qtgavfnnaaqiwnhtfywnsmgp

Timeline for d4k2wb1:

• d4k2wb1 first appeared in SCOPe 2.03
  
• d4k2wb1 appears in SCOPe 2.04
  
• d4k2wb1 does not appear in SCOPe 2.06