Lineage for d4k2wb1 (4k2w B:0-83)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1256372Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1256627Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 1256892Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 1256893Protein automated matches [226859] (26 species)
    not a true protein
  7. 1256907Species Babesia bovis [TaxId:5865] [226662] (1 PDB entry)
  8. 1256909Domain d4k2wb1: 4k2w B:0-83 [224127]
    Other proteins in same PDB: d4k2wa2, d4k2wb2
    automated match to d1gv3a1
    complexed with zn

Details for d4k2wb1

PDB Entry: 4k2w (more details), 1.75 Å

PDB Description: x-ray crystal structure of superoxide dismutase from babesia bovis solved by sulfur/zinc sad
PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d4k2wb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k2wb1 a.2.11.0 (B:0-83) automated matches {Babesia bovis [TaxId: 5865]}
smafklpalpygmreliphiseetlsfhygkhhagyvnklnslikgtpmesctieelilg
qtgavfnnaaqiwnhtfywnsmgp

SCOPe Domain Coordinates for d4k2wb1:

Click to download the PDB-style file with coordinates for d4k2wb1.
(The format of our PDB-style files is described here.)

Timeline for d4k2wb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4k2wb2