SCOPe 2.04: Domain d4k2wa1: 4k2w A:2-83

Lineage for d4k2wa1 (4k2w A:2-83)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (26 species)
   not a true protein

7. Species Babesia bovis [TaxId:5865] [226662] (1 PDB entry)

8. Domain d4k2wa1: 4k2w A:2-83 [224125]
   Other proteins in same PDB: d4k2wa2, d4k2wb2
   automated match to d1gv3a1
   complexed with zn

Details for d4k2wa1

PDB Entry: 4k2w, 1.75 Å

PDB Description: x-ray crystal structure of superoxide dismutase from babesia bovis solved by sulfur/zinc sad

PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d4k2wa1:

Sequence; same for both SEQRES and ATOM records:

>d4k2wa1 a.2.11.0 (A:2-83) automated matches {Babesia bovis [TaxId: 5865]}
afklpalpygmreliphiseetlsfhygkhhagyvnklnslikgtpmesctieelilgqt
gavfnnaaqiwnhtfywnsmgp

Timeline for d4k2wa1:

• d4k2wa1 first appeared in SCOPe 2.03
  
• d4k2wa1 last appears in SCOPe 2.05