Class a: All alpha proteins [46456] (284 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) automatically mapped to Pfam PF00081 |
Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
Protein automated matches [226859] (26 species) not a true protein |
Species Babesia bovis [TaxId:5865] [226662] (1 PDB entry) |
Domain d4k2wa1: 4k2w A:2-83 [224125] Other proteins in same PDB: d4k2wa2, d4k2wb2 automated match to d1gv3a1 complexed with zn |
PDB Entry: 4k2w (more details), 1.75 Å
SCOPe Domain Sequences for d4k2wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k2wa1 a.2.11.0 (A:2-83) automated matches {Babesia bovis [TaxId: 5865]} afklpalpygmreliphiseetlsfhygkhhagyvnklnslikgtpmesctieelilgqt gavfnnaaqiwnhtfywnsmgp
Timeline for d4k2wa1: