SCOPe 2.04: Domain d4k2ul2: 4k2u L:108-210

Lineage for d4k2ul2 (4k2u L:108-210)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)

8. Domain d4k2ul2: 4k2u L:108-210 [224122]
   Other proteins in same PDB: d4k2ua_, d4k2ub_
   automated match to d1h0da2
   complexed with so4

Details for d4k2ul2

PDB Entry: 4k2u, 2.45 Å

PDB Description: crystal structure of pfeba-175 f1 in complex with r218 antibody fab fragment

PDB Compounds: (L:) Antibody Light Chain

SCOPe Domain Sequences for d4k2ul2:

Sequence, based on SEQRES records:

>d4k2ul2 b.1.1.0 (L:108-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathkkgefqhtggry

Sequence, based on observed residues (ATOM records):

>d4k2ul2 b.1.1.0 (L:108-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyhnsytceathkkgefqhtggry

Timeline for d4k2ul2:

• d4k2ul2 first appeared in SCOPe 2.03
  
• d4k2ul2 appears in SCOPe 2.05
  
• d4k2ul2 appears in the current release, SCOPe 2.08