Lineage for d4k2ul2 (4k2u L:108-210)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760696Domain d4k2ul2: 4k2u L:108-210 [224122]
    Other proteins in same PDB: d4k2ua_, d4k2ub_, d4k2uh_, d4k2ui_
    automated match to d1h0da2
    complexed with so4

Details for d4k2ul2

PDB Entry: 4k2u (more details), 2.45 Å

PDB Description: crystal structure of pfeba-175 f1 in complex with r218 antibody fab fragment
PDB Compounds: (L:) Antibody Light Chain

SCOPe Domain Sequences for d4k2ul2:

Sequence, based on SEQRES records: (download)

>d4k2ul2 b.1.1.0 (L:108-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathkkgefqhtggry

Sequence, based on observed residues (ATOM records): (download)

>d4k2ul2 b.1.1.0 (L:108-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyhnsytceathkkgefqhtggry

SCOPe Domain Coordinates for d4k2ul2:

Click to download the PDB-style file with coordinates for d4k2ul2.
(The format of our PDB-style files is described here.)

Timeline for d4k2ul2: