![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.264: Duffy binding domain-like [140923] (1 superfamily) consist of two subdomains, each containing a three-helical bundle |
![]() | Superfamily a.264.1: Duffy binding domain-like [140924] (2 families) ![]() automatically mapped to Pfam PF05424 |
![]() | Family a.264.1.0: automated matches [227296] (1 protein) not a true family |
![]() | Protein automated matches [227121] (1 species) not a true protein |
![]() | Species Plasmodium falciparum [TaxId:36329] [226689] (1 PDB entry) |
![]() | Domain d4k2ub_: 4k2u B: [224120] Other proteins in same PDB: d4k2uh_, d4k2ui_, d4k2ul1, d4k2ul2, d4k2um1, d4k2um2 automated match to d2c6ja1 complexed with so4 |
PDB Entry: 4k2u (more details), 2.45 Å
SCOPe Domain Sequences for d4k2ub_:
Sequence, based on SEQRES records: (download)
>d4k2ub_ a.264.1.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]} evlsncrekrkgmkwdckkkndrsnyvcipdrriqlcivnlsiiktytketmkdhfieas kkesqlllkkndnkynskfcndlknsfldyghlamgndmdfggystkaenkiqevfkgah geisehkiknfrkkwwnefreklweamlsehknninncknipqeelqitqwikewhgefl lerdnrsklpkskcknntlyeacekecidpcmkyrdwiirskfewhtlskeyetqkvpke naenylikisenkndakvslllnncdaeyskycdc
>d4k2ub_ a.264.1.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]} evlsncrekrkgmkwdckkknyvcipdrriqlcivnlsiiktytketmkdhfieaskkes qlllkkndnkynskfcndlknsfldyghlamgndmdfgystkaenkiqevfkisehkikn frkkwwnefreklweamlsehknninncknipqeelqitqwikewhgefllerdnrsklp kskcklyeacekcidpcmkyrdwiirskfewhtlskeyetqkvpkenaenylikisdakv slllnncdaeyskycdc
Timeline for d4k2ub_: