Lineage for d4k2ub_ (4k2u B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016272Fold a.264: Duffy binding domain-like [140923] (1 superfamily)
    consist of two subdomains, each containing a three-helical bundle
  4. 2016273Superfamily a.264.1: Duffy binding domain-like [140924] (2 families) (S)
    automatically mapped to Pfam PF05424
  5. 2016295Family a.264.1.0: automated matches [227296] (1 protein)
    not a true family
  6. 2016296Protein automated matches [227121] (1 species)
    not a true protein
  7. 2016297Species Plasmodium falciparum [TaxId:36329] [226689] (1 PDB entry)
  8. 2016299Domain d4k2ub_: 4k2u B: [224120]
    Other proteins in same PDB: d4k2ul1, d4k2ul2, d4k2um1, d4k2um2
    automated match to d2c6ja1
    complexed with so4

Details for d4k2ub_

PDB Entry: 4k2u (more details), 2.45 Å

PDB Description: crystal structure of pfeba-175 f1 in complex with r218 antibody fab fragment
PDB Compounds: (B:) Erythrocyte binding antigen 175

SCOPe Domain Sequences for d4k2ub_:

Sequence, based on SEQRES records: (download)

>d4k2ub_ a.264.1.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
evlsncrekrkgmkwdckkkndrsnyvcipdrriqlcivnlsiiktytketmkdhfieas
kkesqlllkkndnkynskfcndlknsfldyghlamgndmdfggystkaenkiqevfkgah
geisehkiknfrkkwwnefreklweamlsehknninncknipqeelqitqwikewhgefl
lerdnrsklpkskcknntlyeacekecidpcmkyrdwiirskfewhtlskeyetqkvpke
naenylikisenkndakvslllnncdaeyskycdc

Sequence, based on observed residues (ATOM records): (download)

>d4k2ub_ a.264.1.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
evlsncrekrkgmkwdckkknyvcipdrriqlcivnlsiiktytketmkdhfieaskkes
qlllkkndnkynskfcndlknsfldyghlamgndmdfgystkaenkiqevfkisehkikn
frkkwwnefreklweamlsehknninncknipqeelqitqwikewhgefllerdnrsklp
kskcklyeacekcidpcmkyrdwiirskfewhtlskeyetqkvpkenaenylikisdakv
slllnncdaeyskycdc

SCOPe Domain Coordinates for d4k2ub_:

Click to download the PDB-style file with coordinates for d4k2ub_.
(The format of our PDB-style files is described here.)

Timeline for d4k2ub_: