Lineage for d4k2na1 (4k2n A:1-259)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2100042Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2100043Protein automated matches [190246] (54 species)
    not a true protein
  7. 2100268Species Magnetospirillum magneticum [TaxId:342108] [226647] (2 PDB entries)
  8. 2100269Domain d4k2na1: 4k2n A:1-259 [224118]
    Other proteins in same PDB: d4k2na2
    automated match to d2iexc_

Details for d4k2na1

PDB Entry: 4k2n (more details), 2 Å

PDB Description: Crystal structure of an enoyl-CoA hydratase/ carnithine racemase from Magnetospirillum magneticum
PDB Compounds: (A:) Enoyl-CoA hydratase/carnithine racemase

SCOPe Domain Sequences for d4k2na1:

Sequence, based on SEQRES records: (download)

>d4k2na1 c.14.1.0 (A:1-259) automated matches {Magnetospirillum magneticum [TaxId: 342108]}
msdviqlvregaiatvtlnrpdrmnalnlpmwrglaeafetisadrsihvvilrgagtka
fapgadieefdtlranaeqakaydlvmrkaldtvracpqpviaaiwgpcvggglelaccc
dirlsaksgkfgvpinkisvvmaypelaqirrvagpaaaleillegrimdadeaaakrlv
nrvveddamdaevaatakriaagaplanrwhkafiarlddptpvseaeldecyrfldtkd
yaeglaafrakrkpvftae

Sequence, based on observed residues (ATOM records): (download)

>d4k2na1 c.14.1.0 (A:1-259) automated matches {Magnetospirillum magneticum [TaxId: 342108]}
mdviqlvregaiatvtlnrpdrmnalnlpmwrglaeafetisadrsihvvilrgagtkaf
apgadieefdtlranaeqakaydlvmrkaldtvracpqpviaaiwgpcvggglelacccd
irlsaksgkfgvpinkisvvmaypelaqirrvagpaaaleillegrimdadeaaakrlvn
rvveddamdaevaatakriaagaplanrwhkafiarlddptpvseaeldecyrfldtkdy
aeglaafrakrkpvftae

SCOPe Domain Coordinates for d4k2na1:

Click to download the PDB-style file with coordinates for d4k2na1.
(The format of our PDB-style files is described here.)

Timeline for d4k2na1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4k2na2