Lineage for d4k2hm_ (4k2h M:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858750Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2859252Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 2859253Protein automated matches [190197] (23 species)
    not a true protein
  7. 2859438Species Salmonella enterica [TaxId:99287] [226648] (1 PDB entry)
  8. 2859451Domain d4k2hm_: 4k2h M: [224116]
    Other proteins in same PDB: d4k2hd2, d4k2hg2
    automated match to d3b36a_
    complexed with zn; mutant

Details for d4k2hm_

PDB Entry: 4k2h (more details), 2.2 Å

PDB Description: crystal structure of c103a mutant of dj-1 superfamily protein stm1931 from salmonella typhimurium
PDB Compounds: (M:) Intracellular protease/amidase

SCOPe Domain Sequences for d4k2hm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k2hm_ c.23.16.0 (M:) automated matches {Salmonella enterica [TaxId: 99287]}
mkkvavllapgfeeaeaivtldilrrlhidvetlacaesravvsyhdipmvadstlserq
qalfdavvlpggpqgsanlaanpaviafvarhdaagklicpiasaaarvlgahgllkgrr
yvcsgdlwkavpegvyvdapvvedgnlisgkglghvfdfaltlsarllgddapvreqaeh
iyypw

SCOPe Domain Coordinates for d4k2hm_:

Click to download the PDB-style file with coordinates for d4k2hm_.
(The format of our PDB-style files is described here.)

Timeline for d4k2hm_: