| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
| Family c.23.16.0: automated matches [191336] (1 protein) not a true family |
| Protein automated matches [190197] (23 species) not a true protein |
| Species Salmonella enterica [TaxId:99287] [226648] (1 PDB entry) |
| Domain d4k2hj_: 4k2h J: [224113] Other proteins in same PDB: d4k2hd2, d4k2hg2 automated match to d3b36a_ complexed with zn; mutant |
PDB Entry: 4k2h (more details), 2.2 Å
SCOPe Domain Sequences for d4k2hj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k2hj_ c.23.16.0 (J:) automated matches {Salmonella enterica [TaxId: 99287]}
mkkvavllapgfeeaeaivtldilrrlhidvetlacaesravvsyhdipmvadstlserq
qalfdavvlpggpqgsanlaanpaviafvarhdaagklicpiasaaarvlgahgllkgrr
yvcsgdlwkavpegvyvdapvvedgnlisgkglghvfdfaltlsarllgddapvreqaeh
iyypw
Timeline for d4k2hj_: