Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.0: automated matches [191336] (1 protein) not a true family |
Protein automated matches [190197] (18 species) not a true protein |
Species Salmonella enterica [TaxId:99287] [226648] (1 PDB entry) |
Domain d4k2hf_: 4k2h F: [224109] automated match to d3b36a_ complexed with zn; mutant |
PDB Entry: 4k2h (more details), 2.2 Å
SCOPe Domain Sequences for d4k2hf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k2hf_ c.23.16.0 (F:) automated matches {Salmonella enterica [TaxId: 99287]} mkkvavllapgfeeaeaivtldilrrlhidvetlacaesravvsyhdipmvadstlserq qalfdavvlpggpqgsanlaanpaviafvarhdaagklicpiasaaarvlgahgllkgrr yvcsgdlwkavpegvyvdapvvedgnlisgkglghvfdfaltlsarllgddapvreqaeh iyypw
Timeline for d4k2hf_: