Lineage for d4k2ha_ (4k2h A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1589127Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 1589536Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 1589537Protein automated matches [190197] (15 species)
    not a true protein
  7. 1589685Species Salmonella enterica [TaxId:99287] [226648] (1 PDB entry)
  8. 1589686Domain d4k2ha_: 4k2h A: [224104]
    automated match to d3b36a_
    complexed with zn; mutant

Details for d4k2ha_

PDB Entry: 4k2h (more details), 2.2 Å

PDB Description: crystal structure of c103a mutant of dj-1 superfamily protein stm1931 from salmonella typhimurium
PDB Compounds: (A:) Intracellular protease/amidase

SCOPe Domain Sequences for d4k2ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k2ha_ c.23.16.0 (A:) automated matches {Salmonella enterica [TaxId: 99287]}
mkkvavllapgfeeaeaivtldilrrlhidvetlacaesravvsyhdipmvadstlserq
qalfdavvlpggpqgsanlaanpaviafvarhdaagklicpiasaaarvlgahgllkgrr
yvcsgdlwkavpegvyvdapvvedgnlisgkglghvfdfaltlsarllgddapvreqaeh
iyypw

SCOPe Domain Coordinates for d4k2ha_:

Click to download the PDB-style file with coordinates for d4k2ha_.
(The format of our PDB-style files is described here.)

Timeline for d4k2ha_: