SCOPe 2.03: Domain d4k0xa_: 4k0x A:

Lineage for d4k0xa_ (4k0x A:)

1. Root: SCOPe 2.03

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (15 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [194613] (18 PDB entries)

8. Domain d4k0xa_: 4k0x A: [224100]
   automated match to d3qnbd_
   complexed with bct

Details for d4k0xa_

PDB Entry: 4k0x, 1.61 Å

PDB Description: X-ray Crystal Structure of OXA-23 from Acinetobacter baumannii

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d4k0xa_:

Sequence; same for both SEQRES and ATOM records:

>d4k0xa_ e.3.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]}
qivqghnqvihqyfdekntsgvlviqtdkkinlygnalsranteyvpastfkmlnaligl
enqktdineifkwkgekrsftawekdmtlgeamklsavpvyqelarrigldlmqkevkri
gfgnaeigqqvdnfwlvgplkvtpiqevefvsqlahtqlpfsekvqanvknmllleesng
ykifgktgwamdikpqvgwltgwveqpdgkivafalnmemrsempasirnellmkslkql
nii

Timeline for d4k0xa_:

• d4k0xa_ is new in SCOPe 2.03-stable
  
• d4k0xa_ appears in SCOPe 2.04
  
• d4k0xa_ appears in the current release, SCOPe 2.08