Lineage for d1amx__ (1amx -)
- Root: SCOP 1.67
Class b: All beta proteins [48724] (141 folds) 
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies)
sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
Superfamily b.2.3: Bacterial adhesins [49401] (5 families) 
Family b.2.3.1: Collagen-binding domain of adhesin [49402] (1 protein) Protein Collagen-binding domain of adhesin [49403] (1 species) Species Staphylococcus aureus [TaxId:1280] [49404] (1 PDB entry) 
Domain d1amx__: 1amx - [22410]
Details for d1amx__
PDB Entry: 1amx (more details), 2 Å
PDB Description: collagen-binding domain from a staphylococcus aureus adhesin
SCOP Domain Sequences for d1amx__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1amx__ b.2.3.1 (-) Collagen-binding domain of adhesin {Staphylococcus aureus}
tssvfyyktgdmlpedtthvrwflninneksyvskditikdqiqggqqldlstlninvtg
thsnyysgqsaitdfekafpgskitvdntkntidvtipqgygsynsfsinyktkitneqq
kefvnnsqawyqehgkeevngksfnhtvhn
SCOP Domain Coordinates for d1amx__:
Click to download the PDB-style file with coordinates for d1amx__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1amx__:
- d1amx__ first appeared (with stable ids) in SCOP 1.55
- d1amx__ appears in SCOP 1.65
- d1amx__ appears in SCOP 1.69
- d1amx__ appears in the current release, SCOPe 2.08, called d1amxa_
View in 3D