| Class b: All beta proteins [48724] (180 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
| Family b.2.3.1: Collagen-binding domain of adhesin [49402] (1 protein) automatically mapped to Pfam PF05737 |
| Protein Collagen-binding domain of adhesin [49403] (1 species) |
| Species Staphylococcus aureus [TaxId:1280] [49404] (1 PDB entry) |
| Domain d1amxa_: 1amx A: [22410] |
PDB Entry: 1amx (more details), 2 Å
SCOPe Domain Sequences for d1amxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1amxa_ b.2.3.1 (A:) Collagen-binding domain of adhesin {Staphylococcus aureus [TaxId: 1280]}
tssvfyyktgdmlpedtthvrwflninneksyvskditikdqiqggqqldlstlninvtg
thsnyysgqsaitdfekafpgskitvdntkntidvtipqgygsynsfsinyktkitneqq
kefvnnsqawyqehgkeevngksfnhtvhn
Timeline for d1amxa_: