SCOPe 2.06: Domain d4jz9c_: 4jz9 C:

Lineage for d4jz9c_ (4jz9 C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (4 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.0: automated matches [191466] (1 protein)
   not a true family

6. Protein automated matches [190728] (15 species)
   not a true protein

7. Species Giardia lamblia [TaxId:184922] [197259] (5 PDB entries)

8. Domain d4jz9c_: 4jz9 C: [224093]
   automated match to d4jz7a_
   complexed with cit

Details for d4jz9c_

PDB Entry: 4jz9, 2.4 Å

PDB Description: Carbamate kinase from Giardia lamblia bound to citric acid

PDB Compounds: (C:) carbamate kinase

SCOPe Domain Sequences for d4jz9c_:

Sequence; same for both SEQRES and ATOM records:

>d4jz9c_ c.73.1.0 (C:) automated matches {Giardia lamblia [TaxId: 184922]}
msagktvvialggnamlqakekgdydtqrknveiaaseiykihkagykvvltsgngpqvg
aiklqnqaaagvspemplhvcgamsqgfigymmsqamdnvfcannepancvtcvtqtlvd
pkdqaftnptkpvgrfyteqeakdlmaanpgkilredagrgwrvvvpsprpleiveygvi
ktlidnnvlvictngggipckrenkvisgvdavidkdlatsllaktlnsdylmiltdvln
acinykkpderkleeiklseilalekdghfaagsmgpkvraaieftqatgkmsiitslst
avdalngkcgtriikd

Timeline for d4jz9c_:

• d4jz9c_ first appeared in SCOPe 2.03
  
• d4jz9c_ appears in SCOPe 2.05
  
• d4jz9c_ appears in SCOPe 2.07
  
• d4jz9c_ appears in the current release, SCOPe 2.08