Lineage for d4jz9b_ (4jz9 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1872996Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 1872997Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 1873135Family c.73.1.0: automated matches [191466] (1 protein)
    not a true family
  6. 1873136Protein automated matches [190728] (15 species)
    not a true protein
  7. 1873164Species Giardia lamblia [TaxId:184922] [197259] (5 PDB entries)
  8. 1873170Domain d4jz9b_: 4jz9 B: [224092]
    automated match to d4jz7a_
    complexed with cit

Details for d4jz9b_

PDB Entry: 4jz9 (more details), 2.4 Å

PDB Description: Carbamate kinase from Giardia lamblia bound to citric acid
PDB Compounds: (B:) carbamate kinase

SCOPe Domain Sequences for d4jz9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jz9b_ c.73.1.0 (B:) automated matches {Giardia lamblia [TaxId: 184922]}
msagktvvialggnamlqakekgdydtqrknveiaaseiykihkagykvvltsgngpqvg
aiklqnqaaagvspemplhvcgamsqgfigymmsqamdnvfcannepancvtcvtqtlvd
pkdqaftnptkpvgrfyteqeakdlmaanpgkilredagrgwrvvvpsprpleiveygvi
ktlidnnvlvictngggipckrenkvisgvdavidkdlatsllaktlnsdylmiltdvln
acinykkpderkleeiklseilalekdghfaagsmgpkvraaieftqatgkmsiitslst
avdalngkcgtriikd

SCOPe Domain Coordinates for d4jz9b_:

Click to download the PDB-style file with coordinates for d4jz9b_.
(The format of our PDB-style files is described here.)

Timeline for d4jz9b_: