Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.73: Carbamate kinase-like [53632] (1 superfamily) 3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest |
Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase |
Family c.73.1.0: automated matches [191466] (1 protein) not a true family |
Protein automated matches [190728] (15 species) not a true protein |
Species Giardia lamblia [TaxId:184922] [197259] (5 PDB entries) |
Domain d4jz9b_: 4jz9 B: [224092] automated match to d4jz7a_ complexed with cit |
PDB Entry: 4jz9 (more details), 2.4 Å
SCOPe Domain Sequences for d4jz9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jz9b_ c.73.1.0 (B:) automated matches {Giardia lamblia [TaxId: 184922]} msagktvvialggnamlqakekgdydtqrknveiaaseiykihkagykvvltsgngpqvg aiklqnqaaagvspemplhvcgamsqgfigymmsqamdnvfcannepancvtcvtqtlvd pkdqaftnptkpvgrfyteqeakdlmaanpgkilredagrgwrvvvpsprpleiveygvi ktlidnnvlvictngggipckrenkvisgvdavidkdlatsllaktlnsdylmiltdvln acinykkpderkleeiklseilalekdghfaagsmgpkvraaieftqatgkmsiitslst avdalngkcgtriikd
Timeline for d4jz9b_: