Lineage for d1c7ta2 (1c7t A:28-200)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 789808Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 789822Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families) (S)
  5. 789897Family b.2.2.3: Bacterial chitobiase, n-terminal domain [49398] (1 protein)
  6. 789898Protein Bacterial chitobiase, n-terminal domain [49399] (1 species)
  7. 789899Species Serratia marcescens [TaxId:615] [49400] (4 PDB entries)
  8. 789903Domain d1c7ta2: 1c7t A:28-200 [22409]
    Other proteins in same PDB: d1c7ta1, d1c7ta3, d1c7ta4
    complexed with cbs, so4; mutant

Details for d1c7ta2

PDB Entry: 1c7t (more details), 1.9 Å

PDB Description: beta-n-acetylhexosaminidase mutant e540d complexed with di-n acetyl-d- glucosamine (chitobiase)
PDB Compounds: (A:) beta-n-acetylhexosaminidase

SCOP Domain Sequences for d1c7ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c7ta2 b.2.2.3 (A:28-200) Bacterial chitobiase, n-terminal domain {Serratia marcescens [TaxId: 615]}
dqqlvdqlsqlklnvkmldnragengvdcaalgadwascnrvlftlsndgqaidgkdwvi
yfhsprqtlrvdndqfkiahltgdlykleptakfsgfpagkaveipvvaeywqlfrndfl
prwyatsgdakpkmlantdtenldqfvapftgdqwkrtkddknilmtpasrfv

SCOP Domain Coordinates for d1c7ta2:

Click to download the PDB-style file with coordinates for d1c7ta2.
(The format of our PDB-style files is described here.)

Timeline for d1c7ta2: