Class b: All beta proteins [48724] (176 folds) |
Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily) barrel, closed; n=6, S=10; complex topology |
Superfamily b.53.1: Ribosomal protein L25-like [50715] (3 families) |
Family b.53.1.2: Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain [50719] (1 protein) automatically mapped to Pfam PF03950 |
Protein Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain [50720] (2 species) duplication, consists of two barrel domains with the swapping of N-terminal strands |
Species Escherichia coli [TaxId:562] [50721] (17 PDB entries) |
Domain d4jyza2: 4jyz A:339-548 [224086] Other proteins in same PDB: d4jyza1 automated match to d1gtra1 protein/RNA complex; complexed with atp, so4 |
PDB Entry: 4jyz (more details), 2.5 Å
SCOPe Domain Sequences for d4jyza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jyza2 b.53.1.2 (A:339-548) Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain {Escherichia coli [TaxId: 562]} apramavidpvklvienyqgegemvtmpnhpnkpemgsrqvpfsgeiwidradfreeank qykrlvlgkevrlrnayvikaervekdaegnittifctydadtlskdpadgrkvkgvihw vsaahalpveirlydrlfsvpnpgaaddflsvinpeslvikqgfaepslkdavagkafqf eregyfcldsrhstaekpvfnrtvglrdtw
Timeline for d4jyza2: